NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103961_1153816

Scaffold Ga0103961_1153816


Overview

Basic Information
Taxon OID3300007216 Open in IMG/M
Scaffold IDGa0103961_1153816 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1118
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.409238Long. (o)103.907928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069738Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0103961_11538162F069738N/AMKLEKIQKKIDKLVSTWVGEKSVPSIIRGLNKSFHKSIIYFTSNRYDEEYFEHHSVIISGQYCPRIMSAIPENILITLSFPKNKKKVLITEKESKNLALKIARAIHHEYRHKHQQKGRGYVYTKQYAPKPYQNRMKTIYYGNPDEIDAHAYETQAEKLDINKLRKAHKIGWRESEAIFMYRLHFRKTDPKIWKRFLKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.