NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104734_1025113

Scaffold Ga0104734_1025113


Overview

Basic Information
Taxon OID3300007289 Open in IMG/M
Scaffold IDGa0104734_1025113 Open in IMG/M
Source Dataset NameActivated sludge microbial communities from aeration tank of chemical wastewater treatment plant in Ankleshwar, Gujarat, India ? sample Ank1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterXcelris Genomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2982
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aeration Tank Of Activted Sludge Process → Activated Sludge Process Metagenomes

Source Dataset Sampling Location
Location NameGujarat, Ankleshwar, India
CoordinatesLat. (o)21.6266027Long. (o)73.0119202Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015419Metagenome / Metatranscriptome255Y

Sequences

Protein IDFamilyRBSSequence
Ga0104734_10251137F015419N/AMKLELKITDEHGNEHLYNVVRSSSDEPKNLNDFILEALSISEDKRQLPFLIQCPNGLEVYPSIKMKFENYGSSLLGDKLEAMMVTWRD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.