NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104787_100395

Scaffold Ga0104787_100395


Overview

Basic Information
Taxon OID3300007361 Open in IMG/M
Scaffold IDGa0104787_100395 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit 2, subject 158337416 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)49090
Total Scaffold Genes45 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)32 (71.11%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075480Metagenome119N
F087213Metagenome110N

Sequences

Protein IDFamilyRBSSequence
Ga0104787_10039518F075480AGGAGMNKTKQEKWQRAYGDTPDSFRQRVASSLPKGQETRHVAFPRRAMVLAAALVLVLTTAYAAVVTHTELVWNAGHPIENEADDRLGLLTGKAGTSGDSLTIGGVTFTVQDGIYSPETGQLFASAVISADESVQLVGVESDMEWEVRAVTPVSEKLDPSGISWAEWAEQNGKTLVPVRMEIRGSEQFPNIPMFCDFLTQNPDGTVSAGFQVDLTEADTSHLKSCEVQLECRVGVFGKDGKATQWQKEILTATITFK*
Ga0104787_10039531F087213AGGMKKFSSVLLAVLLIFSCWTVATAESTDAVSGAPLDNDIEIVYKEHFDDMVTRYADELTEAELLVSADVYDAIGMIRFDSEDSLAARQRIYGIASADDLHAILTGYFDPNDAAYTADTALDARLQAILAACGLNPEDYDISVIRNLSGMPEPITGTNWYCTLIRKGIEVAEDETNPYDMVIVLYGDEMTVGAFVLNPEV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.