Basic Information | |
---|---|
Taxon OID | 3300007504 Open in IMG/M |
Scaffold ID | Ga0104999_1033232 Open in IMG/M |
Source Dataset Name | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Georgia Genomics Facility |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2632 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cariaco Basin, Venezuela | |||||||
Coordinates | Lat. (o) | 10.5 | Long. (o) | -64.66 | Alt. (m) | Depth (m) | 267 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F095598 | Metagenome / Metatranscriptome | 105 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104999_10332322 | F095598 | AGG | MIRIATNGDIKQIANVVKEAHKLSISNSVPLDDKILFKNLQICIFSKEHLVNVVDLGTIEGVFIGVTHQLWYSRKKQAADLFFYVTEEGKGWGAPLLRRYIQWARVNPGVAEISMGVSSGIGDIERTCKLYERMGAVKTGDNFVLPKEK* |
⦗Top⦘ |