NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104999_1049385

Scaffold Ga0104999_1049385


Overview

Basic Information
Taxon OID3300007504 Open in IMG/M
Scaffold IDGa0104999_1049385 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1928
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)267
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056672Metagenome / Metatranscriptome137N
F066124Metagenome127N
F069327Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0104999_10493852F069327GAGGMRRWDEREKAFDGDTPEEIIDDFEVAKWEVSSYRYKKEHFLIGLDLISEGKRIDERLDFWESRLEILCRENYKLLKSKGKDVDEIMDFFSEKTKEKLK*
Ga0104999_10493853F066124GAGGMGRWDEYSGTDVELLADFRNLQMQLLHRKDRRKNALGKEEIEKVDSEIKKLYQEMKELYERNHKRFQFSEFMRKTKGFECFAWFLMLSEDTKKRLR*
Ga0104999_10493855F056672AGGAGMKAQEYNLTGNEKFSVWFTTMMMMTNAQLDHDSKARILKMAKIMCVGECLDMQKLENDDPAEMEKSKEKQKELDAMKDAIWKEMDKIQEVLTACYGEPRKGNKHHRCRHND*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.