NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105016_1042928

Scaffold Ga0105016_1042928


Overview

Basic Information
Taxon OID3300007512 Open in IMG/M
Scaffold IDGa0105016_1042928 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBigelow Laboratory Single Cell Genomics Center (SCGC)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3387
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)247
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F080925Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0105016_10429283F080925N/AMPEVQDIKHTGPVLKHKQSKTEILPRLSSRICVAGPSGVGKGVLVMQLLTNPEFYRGCFERIFYFSQSAAVDSNLLGLKAYCEKELGQTEECLFSEFDEGFLRDLLNRQLKITKLLKQRAANGGPKKAMGVAVVIDDFIDMPSVVRKANGVLSSIAIRGRHGNVTCFYMTQKYRALGTEIRTNFNALMFFRQRSRFDLEAFLEENSAIIPREQLYQMYVKATGKDHGFLYCNLMQSDPAKMFYSSFNARLVPKGMLSVEDGEDEG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.