NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105020_1007318

Scaffold Ga0105020_1007318


Overview

Basic Information
Taxon OID3300007514 Open in IMG/M
Scaffold IDGa0105020_1007318 Open in IMG/M
Source Dataset NameMarine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Genomics Facility
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12000
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)16 (64.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Water Column Microbial Communities Of The Permanently Stratified Cariaco Basin, Venezuela

Source Dataset Sampling Location
Location NameCariaco Basin, Venezuela
CoordinatesLat. (o)10.5Long. (o)-64.66Alt. (m)Depth (m)143
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007004Metagenome / Metatranscriptome360Y
F009987Metagenome / Metatranscriptome310Y
F045800Metagenome / Metatranscriptome152Y
F067819Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0105020_10073182F045800AGGGGGMEDLIAVREYLEAMIEHYKHTSSPVLAERRKTYKDVKIAIFGESEIDDEDTRKENTQAWIC*
Ga0105020_100731820F067819AGGAGMESLFLAWGESQSWWGTLCSVIVIANAITLAVKDQYAEKLPIIGKIWPIMNWLALNVHNNKNAK*
Ga0105020_10073187F007004AGGGGGMKNIMLGICLIVMVGCQTSNAYQRPDVRIVGEAQMKKLDNGNYEVTPRWIKDRFDAENSMLKQLEDCREGGR*
Ga0105020_10073189F009987GGAMFKLMINLIGNALGLGLKIMDKIDKNSDKPSFEEFKGRKKEMDKSLADEDVNGIDSMFEYLAERARAGKTGRKG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.