Scaffold Ga0105050_10159248

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105050_10159248

Scaffold Ga0105050_10159248

Overview

Basic Information
Taxon OID	3300007516 Open in IMG/M
Scaffold ID	Ga0105050_10159248 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1437
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (57.14%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location Name	Lake Fryxell, Antarctica
Coordinates	Lat. (^o)	-77.605	Long. (^o)	163.163	Alt. (m)		Depth (m)	18
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007261	Metagenome / Metatranscriptome	354	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105050_101592485	F007261	GAG	MTIIVLPTYQKHWIYTKPYGHDIVIWCDTGKTTIQCKWQDVERTKDGRVKQKELI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.