 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300007570 Open in IMG/M |
| Scaffold ID | Ga0101524_1053653 Open in IMG/M |
| Source Dataset Name | Marine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', co11ds |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 616 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -9.73665 | Long. (o) | 150.867667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085224 | Metagenome | 111 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101524_10536532 | F085224 | N/A | LNGFSYQDLLRFKAIVMFPYSAFSGIMLELIEMGVPMFYPSKSLLKRWDESYGMMFQRTSGYGRRSAGGFSNIAYGKDSAPDPNDGVNREALHYWLEKSEWYNWDVRYFDSPADLHEQLKQADFEALHRDVLKTRARMDKIRDERWAEIKRDLTKTSSTPA* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |