NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102799_1403289

Scaffold Ga0102799_1403289


Overview

Basic Information
Taxon OID3300007613 Open in IMG/M
Scaffold IDGa0102799_1403289 Open in IMG/M
Source Dataset NameMarine microbial communities from the Southern Atlantic ocean - KN S19 Surf_A metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)728
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic Ocean
CoordinatesLat. (o)-28.2362Long. (o)-38.4949Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012353Metagenome / Metatranscriptome281N
F034958Metagenome / Metatranscriptome173Y

Sequences

Protein IDFamilyRBSSequence
Ga0102799_14032891F034958AGGAMKSEIDQMIDNLEVCIDFLGLNDEQTGEVLAATNEIGVNVEYFCHEFMETSSATVHDNDYLNIALFNAMYWE
Ga0102799_14032892F012353N/ANQQFILSMTLYTSGDWKVDPNKDITFPLVDWIVKLFPVLKDKEIEINQVDLDGEFAMGFCQDNDGEFLIHVHNGLDIKEYVKTLIHEFTHVRQTVDGITDSNAREDEAYYLEEQLSKAFWDNNISGTQDVDL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.