NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102867_1010621

Scaffold Ga0102867_1010621


Overview

Basic Information
Taxon OID3300007716 Open in IMG/M
Scaffold IDGa0102867_1010621 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - metaG 1546B-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2305
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (81.82%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.2311Long. (o)-123.8825Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004431Metagenome / Metatranscriptome438Y
F009143Metagenome / Metatranscriptome322Y
F011386Metagenome / Metatranscriptome291Y
F045755Metagenome / Metatranscriptome152N

Sequences

Protein IDFamilyRBSSequence
Ga0102867_10106211F011386AGGAGMKLTITTMQGNTRNIELMTTQGVHDFIELYNSTLHPNQRVKVTCDLLGIDGYLQGSC*
Ga0102867_101062110F009143GGAGMMTKWDTIQLDVADQYIYIDEEEAYNKALEEGNISLLDVNDFDEDELSKSLTLDWEAYE*
Ga0102867_101062111F004431N/AHYNQLTKEEQTMTITYSLWDGAQLLGAGLTANSADEMNKVVADLQKVSTNVVAHMRKVTQN*
Ga0102867_10106212F045755GAGGMSEIAGMWICDNCDTLAIVSVETDTILVTQCECVSKERNK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.