NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105051_10023453

Scaffold Ga0105051_10023453


Overview

Basic Information
Taxon OID3300007722 Open in IMG/M
Scaffold IDGa0105051_10023453 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5246
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater → Freshwater Microbial Communities From Lake Liftoff Mats And Glacier Meltwater In Antarctica

Source Dataset Sampling Location
Location NameLake Fryxell
CoordinatesLat. (o)-77.605Long. (o)163.163Alt. (m)Depth (m)18
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015655Metagenome / Metatranscriptome253Y
F024033Metagenome / Metatranscriptome207Y

Sequences

Protein IDFamilyRBSSequence
Ga0105051_100234531F015655N/ADGVEYKLRTHLISPTIQANEIYQSLDILDMEKDSNDNYSDQLLLDIIEDVKAEKAEYEKYLQYKKSYIKFMKTSETKFEKLYETNPEIFNLLEEYDYIHPSEFKHEPPKVDIIILDDLLGSNAFTRKTQSVLTNAMIKNRHCGINYSVLVQSIRVVPKTIRSNCSIFQLAKFGSKKVILFDIYEEVSNVISVEKFEMLYDHATSTKYGLLIIDTTNGDKRFLSNFDSELFITDEKPKN*
Ga0105051_100234532F024033N/ALDDFEIQKDLLMRQAQILYPYCEKWVMDLAMEAYFNSLKSPVMNVEEPTIEIN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.