NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102951_1075346

Scaffold Ga0102951_1075346


Overview

Basic Information
Taxon OID3300007725 Open in IMG/M
Scaffold IDGa0102951_1075346 Open in IMG/M
Source Dataset NameWater microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)968
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water → Salt Pond Water, Soil And Salt Crust Microbial Communities From South San Francisco Under Conditions Of Wetland Restoration.

Source Dataset Sampling Location
Location NameSouth San Francisco, USA
CoordinatesLat. (o)37.496Long. (o)-122.1329Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002691Metagenome / Metatranscriptome536Y

Sequences

Protein IDFamilyRBSSequence
Ga0102951_10753461F002691N/AMHISGYNGADEDEIMDNIFGRFSKEGRTTSGHKTGQKLLMKDDAKLAAGTILEAAHKLQPKDVPGYLDANFEKSWNHFDQNHEGWIRYEETHTFQRHLQGALNKFTAAPGSIGDLSSGGSTYPLPYPANAEKVPVGSV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.