NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104988_10676

Scaffold Ga0104988_10676


Overview

Basic Information
Taxon OID3300007735 Open in IMG/M
Scaffold IDGa0104988_10676 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)21894
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (64.71%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameGangwon-do, South Korea
CoordinatesLat. (o)37.953056Long. (o)127.81721Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050228Metagenome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0104988_1067615F050228AGGAGMSGDHNMHQKNKGGKKGLFDDVPLVNPDRDKAWEAFIKRKDVKAMMKHKEVFKFPVDGSYDLWCIVWEKAWREGFYEGWEAAGGKIREP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.