NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105545_1022171

Scaffold Ga0105545_1022171


Overview

Basic Information
Taxon OID3300007748 Open in IMG/M
Scaffold IDGa0105545_1022171 Open in IMG/M
Source Dataset NameMarine sponge C. singaporensis microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', co15aic 200bp-25jan2016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)992
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameUpa-Upasina CO2 seeps 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.828217Long. (o)150.820517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F085224Metagenome111N

Sequences

Protein IDFamilyRBSSequence
Ga0105545_10221712F085224N/ASVFSGMMLELIQMGVPMFYPSKSLLKRWDEKYGMMFHRTNAFGERRAGGFSNIAYGKDSAPDPNDSVNQDALHYWLDKSEFYYWDVRCFDSPADLHEQLKAADFEAMHRDVLKTRARMDKIRDARWAEIRRDLVKTSSTPA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.