Scaffold Ga0105679_11032871

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105679_11032871

Scaffold Ga0105679_11032871

Overview

Basic Information
Taxon OID	3300007790 Open in IMG/M
Scaffold ID	Ga0105679_11032871 Open in IMG/M
Source Dataset Name	Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Norwegian Sequencing Centre (NSC)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1050
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Zebra Blood And Desert Soils. Microbial Community Dynamics Using Metagenomics And Cultivation

Source Dataset Sampling Location
Location Name	Etosha National Park, Namibia
Coordinates	Lat. (^o)	-19.03133	Long. (^o)	15.54865	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041422	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105679_110328712	F041422	N/A	VNRRPTKAYAREQEEGVHNKAGVLGRVKNILAASTRQDWEADGQRLWVHKGDKELRIVDLTDDEGRVQLKEQWARSAAGAGSVALRVELSICQGSLLLAKVPAVWVDSGRAFIPWPCQEEDGRLVVARWQYDLCRVISAGEYLGAYPVRSYLRRAGIVVV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.