Basic Information | |
---|---|
Taxon OID | 3300007819 Open in IMG/M |
Scaffold ID | Ga0104322_128209 Open in IMG/M |
Source Dataset Name | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Princeton University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1480 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil → Permafrost Core Soil Microbial Communities From Svalbard, Norway |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Svalbard, Norway | |||||||
Coordinates | Lat. (o) | 78.11096 | Long. (o) | 15.55294 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F007236 | Metagenome / Metatranscriptome | 355 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0104322_1282093 | F007236 | GGA | MAVENLAEVIRSLSPEEQESVQKFVEFLKRKGSSPSSPFLTAVDEFIDQHPELLRRLAQ* |
⦗Top⦘ |