Basic Information | |
---|---|
Taxon OID | 3300007873 Open in IMG/M |
Scaffold ID | Ga0111036_124152 Open in IMG/M |
Source Dataset Name | Neotropical army ants gut microbial communities from Monteverde, Costa Rica - Labidus sp. Gut microbial communities of Labidus sp. |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Neotropical Army Ants Gut → Army Ant Gut Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Monteverde, Costa Rica | |||||||
Coordinates | Lat. (o) | 10.306961 | Long. (o) | -84.809844 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059647 | Metagenome | 133 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0111036_1241521 | F059647 | N/A | NMASTDPVRPVVGNGGQLWSRISSLNELVHFKAQLSDPGLVYQVIACTAL* |
⦗Top⦘ |