NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111036_161968

Scaffold Ga0111036_161968


Overview

Basic Information
Taxon OID3300007873 Open in IMG/M
Scaffold IDGa0111036_161968 Open in IMG/M
Source Dataset NameNeotropical army ants gut microbial communities from Monteverde, Costa Rica - Labidus sp. Gut microbial communities of Labidus sp.
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)836
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Neotropical Army Ants Gut → Army Ant Gut Microbial Communities

Source Dataset Sampling Location
Location NameMonteverde, Costa Rica
CoordinatesLat. (o)10.306961Long. (o)-84.809844Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059647Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0111036_1619681F059647AGGMRYDATKRQILHNMTSTGPVLPVVGNGDQLLSRISSLNEMVHFKAELRDLGLVYQFMASTAL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.