NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111031_1095236

Scaffold Ga0111031_1095236


Overview

Basic Information
Taxon OID3300007900 Open in IMG/M
Scaffold IDGa0111031_1095236 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf. Combined Assembly of MM1PM1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1415
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Aarhus Bay Station M5, Denmark

Source Dataset Sampling Location
Location NameAarhus Bay station M5
CoordinatesLat. (o)56.10555Long. (o)10.463333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019252Metagenome / Metatranscriptome231Y
F041190Metagenome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0111031_10952364F041190N/AMNAKDLELKISGLQKAIEEKTADASRFQDELKTTQKQLEDINKPELTPLQFNLIQEAIERGVDEFDFSDEGNYDKEFGINYDGKVHLENLDLTCTYELVEMITSRVHKLFTEAVCPEEDDNSQLNNATHVEKVI*
Ga0111031_10952365F019252N/AMRLIDQVKPEVLDALAESKIEFSSSYRRIILSLESVNGYKQLTIDELQTLICFLPDQFKPQGDIDMFYGDNILQEKYKL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.