NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0100400_1072844

Scaffold Ga0100400_1072844


Overview

Basic Information
Taxon OID3300007964 Open in IMG/M
Scaffold IDGa0100400_1072844 Open in IMG/M
Source Dataset NameGroundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1465
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Huberarchaea → Candidatus Huberarchaeum → Candidatus Huberarchaeum crystalense(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)38.9383Long. (o)-110.1342Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001003Metagenome / Metatranscriptome808Y
F104465Metagenome100Y

Sequences

Protein IDFamilyRBSSequence
Ga0100400_10728441F104465N/AKKIDENKKMRKEYNARGERTYENSINRENAKKIRKIK*
Ga0100400_10728444F001003N/AMEKFKKFKQENKDFLLPCNLSTKEKDIFMYLFRLLRKKIDQGIYPEIYNDEIIYTKPDVKSLLLKEIVLCKKYKKGWIITINPTYSTKNVECSRCGAKFNEKIYFRMKRMRCPMCMKGMNGSTTPQKFENDNISTIAKTETKTENKTKTEKVTTDIKSIPTSIERTIEIAKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.