Basic Information | |
---|---|
Taxon OID | 3300008002 Open in IMG/M |
Scaffold ID | Ga0100390_10547979 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 511 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Candidatus Hydrogenedentes bacterium ADurb.Bin170 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah | |||||||
Coordinates | Lat. (o) | 38.9383 | Long. (o) | -110.1342 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086282 | Metagenome | 111 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0100390_105479791 | F086282 | N/A | LSMLILNQINSLSKRFCSNLVIYRHCPVCNGHGAYRHGVYRRTLPDSAVQKVCVPRFLCLNCRKTFSCLPFCLVRRLGISLSDLLRCAASKEPWASLEETLMVARSTLWRWRRTGKKLLAVMPELLALVGDSWVEASHIISRIQYPLSLIKPHPTQAGN* |
⦗Top⦘ |