NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099805_1086891

Scaffold Ga0099805_1086891


Overview

Basic Information
Taxon OID3300008038 Open in IMG/M
Scaffold IDGa0099805_1086891 Open in IMG/M
Source Dataset NameCoral microbial communities from Puerto Morelos, Mexico - Orbicella C B metatranscriptome (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13905
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (28.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NameMexico:Petempiche,Puerto Morelos
CoordinatesLat. (o)20.9047Long. (o)-86.8367Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017438Metagenome / Metatranscriptome240Y
F021048Metagenome / Metatranscriptome220Y
F032145Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0099805_108689112F021048N/AMVVLTIVTQQNGETIYFEEPIPKVHFMKLISCSLFNSWDTLKKEGSATLGDKDKDRALSVSKLLPGHYSLERLAKEIDGLFAKYQYKELQTARNQPVGQLVIRNFGAGAKPIELDRDLANLLGIGRKSSLITFVKRLTYPTTYFIHCDLIDTEQNLFNGKKTDVLALFDVKGKPYEKVSYHGSPQQVLRDCSTGEFINSVTISVKDENGKLFDFKGFPLLFELELN*
Ga0099805_108689119F017438GAGGVKDQNKTEHMNATKFYTDDKFGLVINMCTMADQSMQGTGKRIVNSTDGVQLEIEHKAEGSGDVKCHVFVISDSQFNIMDRQLESVQF*
Ga0099805_108689125F032145GAGMVGGAVLNTTAFIRGNYLARALGGGDKAALEEKKRHDKVLEAYNAAYAKYTHVHTHLLDWIATNAQIKAEAKQNFTNTDYAFKLYNQAHPDEQMAPPKEPKFS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.