Scaffold Ga0110941_1144651

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0110941_1144651

Scaffold Ga0110941_1144651

Overview

Basic Information
Taxon OID	3300008067 Open in IMG/M
Scaffold ID	Ga0110941_1144651 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from the hospital sewers in Singapore - Hospital 5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	826
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3	Long. (^o)	103.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059106	Metagenome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0110941_11446511	F059106	N/A	IVWKIRVILLQIFVWIVDLKVRERLTEYLKKDIKYHQVIIEVLV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.