NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110939_1000468

Scaffold Ga0110939_1000468


Overview

Basic Information
Taxon OID3300008069 Open in IMG/M
Scaffold IDGa0110939_1000468 Open in IMG/M
Source Dataset NameWastewater microbial communities from the hospital sewers in Singapore - Hospital 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5757
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (27.27%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From The Hospital Sewers

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032312Metagenome / Metatranscriptome180N
F060985Metagenome / Metatranscriptome132N
F094005Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0110939_10004685F094005N/ALIFKNKIVYLYNKNKYIIYMKKEIIKLKEGNSVIYQDKTLMEKANVVSIDKKNGTAILSNKVIITRTTNLEGQFTRLDGKGNAIILPCTTENEQKYNAFVAYHQSKKSLEAIKKWLDDNGKHKDDETLEKVITLDKKLKKLIEKLNE*
Ga0110939_10004686F032312GAGMARIKDYDEDLSAPKILRRRDNKGRFIKKDLPPYLGSEQVLKPKNYYHFDSHGNYKGSSMNFDALVCLGFTWFKLLGVALMMLLWPIVFIYALNDGIEGYPFKKYAIPYIFILVAWFIIFLYGLVS*
Ga0110939_10004687F060985GGAMSNIDEKAKNNFIIEMRIFENYEKVKYEIIKAIDFLRHSETPMGMCKIFDNQNYGFWHSVIKPWFQPERFGITHLWFPPGFSFIGYGEYHTIRGNRWLKTPIDKIDRENRIFGYWFPPYKKYIPHRIKVLKLALKDLERIKEILDIIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.