NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0110929_1028806

Scaffold Ga0110929_1028806


Overview

Basic Information
Taxon OID3300008072 Open in IMG/M
Scaffold IDGa0110929_1028806 Open in IMG/M
Source Dataset NameMicrobial Communities in Water bodies, Singapore - Site MA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4502
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (53.85%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies → Microbial Communities In Water Bodies, Singapore

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.3Long. (o)103.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000763Metagenome / Metatranscriptome901Y
F004639Metagenome / Metatranscriptome429Y

Sequences

Protein IDFamilyRBSSequence
Ga0110929_102880612F000763AGGCGGMNMKNPAILTAGAFLSAWAASNFSLDYRAVLWAVLAGVFGYATPKK*
Ga0110929_10288065F004639AGGMGHIQFLNQDGEWESFPTAEQEANLRENAKTLEELGFQLICQMCNKFPNAQQIRDRWLLKEWTCEACHTVNSAGRA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.