NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114340_1010544

Scaffold Ga0114340_1010544


Overview

Basic Information
Taxon OID3300008107 Open in IMG/M
Scaffold IDGa0114340_1010544 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4596
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.7635Long. (o)-83.3309Alt. (m)Depth (m)4.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F010248Metagenome / Metatranscriptome306Y
F013878Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0114340_101054410F000671GAGGMEKILCYSCNKSKNKLDVRKSSLMPINLLICETCNSAKLEPRWVVILAGRSNGPDHVKEFIIKRKYLGSEITASELLI*
Ga0114340_101054412F000473GAGGMFIDKSADKQREHFKYGINHWTGEPNKPVFYTEEMKKAVHQVKKPAMLLMDIVMYPDFLALRLYEDNFLQFDGTKKEMVIDYVTKVKRLLESYGVRCELEGRPSDRVL*
Ga0114340_101054414F013878AGGAMLNLTELGVEVFIKKAKNVTPYWDNYDLVIWRKDSGGFTNIKGMFRENAWGIAERIAITDNGIWKLPTKYVRNFK*
Ga0114340_10105446F010248GAGMRKSERIRLLEMEMLRMQFQIEYLNTAVRLLLEENKVSGPDMDAGKWYAAKLNKNK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.