NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114345_1207619

Scaffold Ga0114345_1207619


Overview

Basic Information
Taxon OID3300008112 Open in IMG/M
Scaffold IDGa0114345_1207619 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-100-LTR
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)666
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.8271Long. (o)-83.1945Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001846Metagenome / Metatranscriptome626Y

Sequences

Protein IDFamilyRBSSequence
Ga0114345_12076191F001846N/AIKGKKYRHHINVIDQLTDNIIGIDFMHQHQLHYDVQTRQVKIAGVDIDQIVAIKEQTLSALSSTVLTAKYKGKIFPDANFIANIFAPRTPMISGMPAIVSIDKNNNCKIVVDNCAPYDVTINRGDILGIMDIEKDELIPMEDSTISAILQDIDKKLPKVPKKKLSREEIANKAHLNVPDQFKQKYIDVLFKHQQAISVNKYDLGLAKNFQHKIHLKDNSPV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.