NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105350_10018794

Scaffold Ga0105350_10018794


Overview

Basic Information
Taxon OID3300008224 Open in IMG/M
Scaffold IDGa0105350_10018794 Open in IMG/M
Source Dataset NameMethane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1E Hudson Canyon
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3376
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (28.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location
Location NameHudson Canyon
CoordinatesLat. (o)39.55Long. (o)-72.4Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F045797Metagenome / Metatranscriptome152Y
F068236Metagenome / Metatranscriptome125Y
F098234Metagenome / Metatranscriptome104Y

Sequences

Protein IDFamilyRBSSequence
Ga0105350_100187941F045797N/AEQEYGGTTYMTKWRAYTVGDLPKNFGCIEYETDVEGIDEWFNYKGLTYVRDNR*
Ga0105350_1001879414F098234N/AMEREQLENRIKELTVLIEESSNGVKNLVEEQAAFTKRLDDLDKPKLSPAQFDEIHEIIETALDRFELDPGNCEFELELDYDNRVQINHFDWSNVHRDLTQHIMDRMEEIFAVDEDEE*
Ga0105350_100187942F068236AGGAMLETTGRNRKFTHDQVIEIAGEYLKCKETGQWVSESNVENYEVERINIEIQQFYDREQDKYY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.