NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105349_10023094

Scaffold Ga0105349_10023094


Overview

Basic Information
Taxon OID3300008253 Open in IMG/M
Scaffold IDGa0105349_10023094 Open in IMG/M
Source Dataset NameMethane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2633
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (28.57%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm → Methane-Oxidizing Microbial Communities From Mesocosms In The Gulf Of Mexico And Hudson Canyon, Usa

Source Dataset Sampling Location
Location NameHudson Canyon
CoordinatesLat. (o)39.55Long. (o)-72.4Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004166Metagenome / Metatranscriptome450N
F006870Metagenome / Metatranscriptome363Y
F007087Metagenome / Metatranscriptome358N
F093220Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
Ga0105349_100230941F093220N/ANLNIIDKNVRVLEKIIDTAENNLTAAIRNACKVKIN*
Ga0105349_100230942F004166N/AMKKLFLLFLLVPLISCSDHQTNNSWGSYATHKETQKQEFWFTSYKTRDECLADMYWQLEGEEDPNKQRISNWHTKPYGCHFMSNNKWLSMYYYLIYGDEDIGCLWESSNPNVRIKYSVTLKTFVNAPEQGRCILGD*
Ga0105349_100230945F007087AGGMKKLLLIALTVPSFALAEDFKLVCQGEVSTFRNDVLEDTSKASRSLQVKDDSMVIDSVTYKNKTFDYGAIKGSSKYVKNDAQVVVETTQVSNECDTALLSVKLNRSSGMIESTSKRIGACDGSSFTTSSKFIGKCK*
Ga0105349_100230946F006870N/AMKKMSQILLLILSLVLTNKVGSFETKLSPQGSDKYNFLIIGGDKSNEKKLRDIFQNKVNEICGTRFEIISIKMNHLSKEGAKKNILNGTFKCFVNSQM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.