NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114840_1009844

Scaffold Ga0114840_1009844


Overview

Basic Information
Taxon OID3300008258 Open in IMG/M
Scaffold IDGa0114840_1009844 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4009
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (62.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.8271Long. (o)-83.1945Alt. (m)Depth (m)7.9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F053106Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0114840_100984412F053106GGAGMGKYYVKSGTLEVIVSKKNAFEAAISGLLLTNKFDDPKTNVIATKSIVRGAGWELSRGDD
Ga0114840_100984414F000325GGAGMKVADGNEKLGKGCVVVSRPVGDTCPPDCDYLDNGCYAENSEKIYPGVRPAAMQNLVTEKNRIRSMILDADRREKSIRWHERGDWFLNGELDLDYLANVTWACESILAEGKTLPDMWFYTHIYDSRLVSLEKYMNVYASVHDDNDMNEAATQGFKLFAWCDSDEKIATKRPRSKAKADAWRKTLPKLVVLNGAKFVTCPEIRRGRGVVTCTPTKGSVSCELCVKGLGNVLFPSH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.