NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114841_1035668

Scaffold Ga0114841_1035668


Overview

Basic Information
Taxon OID3300008259 Open in IMG/M
Scaffold IDGa0114841_1035668 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2518
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie

Source Dataset Sampling Location
Location NameLake Erie, USA
CoordinatesLat. (o)41.7026Long. (o)-83.2538Alt. (m)Depth (m)6
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003456Metagenome / Metatranscriptome485Y
F030018Metagenome / Metatranscriptome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0114841_10356681F003456AGGVANPNGRKGSQFETDVMRFLRSVGLLAERLTKAGSKDEGDIVCVVAGNTYILELKNVKKLDLPKFWSEAEVEALNYAKARGIGEVPLHYVIVKRRNSGIENAWVIQDLKQWLK
Ga0114841_10356686F030018N/ALVAIARDGDEKDVKVHTEAYDEKVALEALSWLANVKAMETAPEPEKDQSFCRLYCQYYDESGEMGCVGLKKERIVLSDVIIEDTEVDTNALMYLQLDQQIKDLEKKKDSLKESFEGATGVTASGIEISWTTVKGRESVDSKEVEKLLGFVPKIVGNESVRLNIKQSGGK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.