Scaffold Ga0115359_10012579

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115359_10012579

Scaffold Ga0115359_10012579

Overview

Basic Information
Taxon OID	3300008340 Open in IMG/M
Scaffold ID	Ga0115359_10012579 Open in IMG/M
Source Dataset Name	Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC10B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2290
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	27.4	Long. (^o)	-93.2	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071990	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115359_100125793	F071990	AGGAGG	MAEPTTRFRLIPQSTAVADINTPAKRLAAIAGESVVSTGIGNEADFGTIDISGGAENSSVLTILWDVTADGGNTLAETFKLWLSSNGFDQAASVIKVQPLSGADXGGAALTENYKANAGTGDYTFASMVXAEPGAINIWPTDEGXSIVLDAVAPCGDDVIFWAMYAAIAAGETTGTYKGTDAGMELQFSFKYSYS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.