Scaffold Ga0115077_116370

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115077_116370

Scaffold Ga0115077_116370

Overview

Basic Information
Taxon OID	3300008408 Open in IMG/M
Scaffold ID	Ga0115077_116370 Open in IMG/M
Source Dataset Name	Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763982056 reassembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1052
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	National Institutes of Health, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042387	Metagenome	158	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0115077_1163702	F042387	AGTAGG	MTDETLANSAKMQLPTKVTIAENKKVISKRFEYQNDNELKEIIDEGSGERIVFVYEKDFITSKIRYSQAGEELGKANYQYNNGKLSSVIDEVVISDSGIQYKRVVTREYHYNGSEVSVNENIKYHSESYAYNLRDENFTHTYVLNGENITKIHHEISKNVPNGHFYLNPNNMVVVDEEVTYDAKNSPYKNIKGFSVLAVEFCGLDEDENTIADYLNFRWVSHNPTLIKKSINLYGSGADSSEYKFQYEYKNKFPIKTKLNIDNQNVTTMVYEYNK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.