Scaffold Ga0115193_1000146

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115193_1000146

Scaffold Ga0115193_1000146

Overview

Basic Information
Taxon OID	3300008412 Open in IMG/M
Scaffold ID	Ga0115193_1000146 Open in IMG/M
Source Dataset Name	Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 638754422 reassembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	46287
Total Scaffold Genes	67 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	54 (80.60%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	National Institutes of Health, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084362	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0115193_100014657	F084362	N/A	MNCTFTVRWSDEKNKPHAKTYATEPAAKKAKKWLLEHGIRNVDIAVKINNKPAGSLKDDKPPETEAEQKGFWWEK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.