Scaffold Ga0115336_104413

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115336_104413

Scaffold Ga0115336_104413

Overview

Basic Information
Taxon OID	3300008464 Open in IMG/M
Scaffold ID	Ga0115336_104413 Open in IMG/M
Source Dataset Name	Deep sea sediment microbial communities from the Gulf of Mexico ? treatment with crude oil and Corexit
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3543
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico

Source Dataset Sampling Location
Location Name	Gulf of Mexico
Coordinates	Lat. (^o)	27.0	Long. (^o)	-88.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092086	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115336_1044131	F092086	N/A	MYNSAVRLEESTVSKYVVSLLAVIALSACSGPEDVLENIGDVSVPDQLTGCVARNDDGGCNKAVCVADEESDCKSFVKACEKHDHIVDVRDGHETCERREAAPDS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.