Basic Information | |
---|---|
Taxon OID | 3300008469 Open in IMG/M |
Scaffold ID | Ga0115369_10025882 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - WM1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | National Aeronautics and Space Administration (NASA) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2399 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Shallow-Sea Hydrothermal Vent, Milos, Greece |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Milos, Greece | |||||||
Coordinates | Lat. (o) | 36.674869 | Long. (o) | 24.520916 | Alt. (m) | Depth (m) | .01 to .2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035190 | Metagenome / Metatranscriptome | 172 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115369_100258821 | F035190 | N/A | MIQEIYNRSPEDPNFNINVLDHSDSIESIISKVKMILGTRQGQIIGDLNFGVGIEDLIFETRLNKIQIEEQILRQIELYITESAYYKISPVVSFGKTNGYDYCIIDIYIDDDKVLGVLVK |
⦗Top⦘ |