NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115369_10069152

Scaffold Ga0115369_10069152


Overview

Basic Information
Taxon OID3300008469 Open in IMG/M
Scaffold IDGa0115369_10069152 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - WM1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterNational Aeronautics and Space Administration (NASA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1369
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Shallow-Sea Hydrothermal Vent, Milos, Greece

Source Dataset Sampling Location
Location NameMilos, Greece
CoordinatesLat. (o)36.674869Long. (o)24.520916Alt. (m)Depth (m).01 to .2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051933Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0115369_100691522F051933N/AMLGFSHQTVFTLCIALVVLTGVSLVSVALLFMERQDVDLLQQRLSNLRQENTLLKSQLGNVRNGLTAQQGATAAPTE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.