Scaffold Ga0115369_10107139

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115369_10107139

Scaffold Ga0115369_10107139

Overview

Basic Information
Taxon OID	3300008469 Open in IMG/M
Scaffold ID	Ga0115369_10107139 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - WM1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	National Aeronautics and Space Administration (NASA)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1058
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment → Marine Sediment Microbial Communities From Shallow-Sea Hydrothermal Vent, Milos, Greece

Source Dataset Sampling Location
Location Name	Milos, Greece
Coordinates	Lat. (^o)	36.674869	Long. (^o)	24.520916	Alt. (m)		Depth (m)	.01 to .2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004052	Metagenome / Metatranscriptome	455	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115369_101071392	F004052	N/A	MCLALTRFLLSCDQQHPVADVDPKLGIECFESQRASPPPGTQYEGIEKLVDDRLMIKIMNGVEVVVIDCALNPAGELQATDK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.