NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114893_106653

Scaffold Ga0114893_106653


Overview

Basic Information
Taxon OID3300008495 Open in IMG/M
Scaffold IDGa0114893_106653 Open in IMG/M
Source Dataset NameHuman attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763577454 reassembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1998
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameNational Institutes of Health, USA
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063777Metagenome129N

Sequences

Protein IDFamilyRBSSequence
Ga0114893_1066533F063777N/ALKVLNIKISALPPENNSFWMKLLFYLCIPFLFIFGILLLIGWGIYSGISSIISAVKEDFFGIKDKTNIKTSKNILFENEQFKLKKEDYLPDENSQEYKIFDDFCAKSNEYLDDGYILYKLTDEKSATDLNGAIISEFQEDIGNYILLQNLILEDNQLKNQLISFNKNTGKITVLADIKDFFWLDFDSETKIINGYNNKEQIEIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.