Scaffold Ga0114893_120544

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114893_120544

Scaffold Ga0114893_120544

Overview

Basic Information
Taxon OID	3300008495 Open in IMG/M
Scaffold ID	Ga0114893_120544 Open in IMG/M
Source Dataset Name	Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763577454 reassembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	698
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location Name	National Institutes of Health, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F057446	Metagenome	136	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0114893_1205442	F057446	N/A	MNSISFGKTSITSYPEYFEITDNKKTNKLLYLSASLVFIAIYLFDLYQNDFDFGKVSHFKTISAVLWLVIFALQFWLINTENKIEKSKIKEVVVRKNRWASIVIHYGGKKRKIDGFSQDEAEQIIKFLMNNR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.