Scaffold Ga0103605_1007638

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103605_1007638

Scaffold Ga0103605_1007638

Overview

Basic Information
Taxon OID	3300008559 Open in IMG/M
Scaffold ID	Ga0103605_1007638 Open in IMG/M
Source Dataset Name	Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-06-47
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	642
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067833	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103605_10076381	F067833	N/A	VTALMAQMKLTVLLHHVKIRVCGIVAMANVFQHHMYVMAQVNFVTQAGLLTVLMAQMKA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.