Basic Information | |
---|---|
Taxon OID | 3300008568 Open in IMG/M |
Scaffold ID | Ga0103784_1003740 Open in IMG/M |
Source Dataset Name | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_total_RNA |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Florida |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 655 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Highborne Cay, Bahamas | |||||||
Coordinates | Lat. (o) | 24.72 | Long. (o) | -76.82 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F015563 | Metagenome / Metatranscriptome | 253 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103784_10037401 | F015563 | N/A | QGLKPAFWGKWGALNPKHAEKYIKMAYNRGYGQPLLTSKVYHADEPTTWLTFFARRYQYDWLKHIAMRVDAQRVPLYVLRRQLWMARFEYYMRRFQTRKAISNAAKVEWAYIKERIAQPFTWTGRDAQHFFFWLLNVAAFFAIGEVIARQNIYGYPVATPEWTPSKPKFAPGFYHTYYPFEDYPFENNPNMITKQFNRSSWWHNTNETYWAPHRVLAT |
⦗Top⦘ |