Scaffold Ga0103655_100987

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103655_100987

Scaffold Ga0103655_100987

Overview

Basic Information
Taxon OID	3300008584 Open in IMG/M
Scaffold ID	Ga0103655_100987 Open in IMG/M
Source Dataset Name	Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_2a
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Auburn University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	536
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Thermoguttaceae → Thermogutta → Thermogutta terrifontis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa

Source Dataset Sampling Location
Location Name	Ohio, USA
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010686	Metagenome / Metatranscriptome	300	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103655_1009871	F010686	N/A	AVVSTQSTWGGQATKGVWGMPRRQEAKKGVEDCDKPGGLVKRELIPGFPNHPIVNP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.