Scaffold Ga0103953_1008482

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103953_1008482

Scaffold Ga0103953_1008482

Overview

Basic Information
Taxon OID	3300008687 Open in IMG/M
Scaffold ID	Ga0103953_1008482 Open in IMG/M
Source Dataset Name	Eukaryotic communities of Beech Litter from forest soil in Germany - LitterTranscript_20121
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	MYCOBT
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	748
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Forest Soil → Eukaryotic Communities Of Beech Litter From Forest Soil In Germany

Source Dataset Sampling Location
Location Name	Germany: Rauhenebrach, Bavaria
Coordinates	Lat. (^o)	49.926	Long. (^o)	10.569	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047473	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103953_10084822	F047473	N/A	MKLILLSLLIWTLVVGNPSYVVDLPKEKWPQGYDGKSPLYTGTATTWCGAASGNMCGLGTLCDQGKLFCGALSDAAFPDLISCKCDSYCSNCGLTECCNNQAPSCDTKFCKAGWCVACNDDKCFNKATFNVTLADACPKYHPNNVNNCCSHNKDPGWCECVSSSVPPNIDLNCAGFSHMASTSTGQVNAYLWAC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.