NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103929_1373

Scaffold Ga0103929_1373


Overview

Basic Information
Taxon OID3300008694 Open in IMG/M
Scaffold IDGa0103929_1373 Open in IMG/M
Source Dataset NamePlanktonic microbial communities from coastal waters of California, USA - Canon-31
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)531
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001478Metagenome / Metatranscriptome687Y

Sequences

Protein IDFamilyRBSSequence
Ga0103929_13731F001478N/ANKGKVLDIQGNVDAENRNIIVHDAHGRINQQWDIVYVDEWKGEPGKGELNEEFGLYVERPFYVVSQMNDNRYLDLINNRNMVIKIPNGRRTQVWYFHQQSLTIRTRYNNQSWDIKNAGKTNDMQIWSTNSQWF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.