Scaffold Ga0103766_1008041

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103766_1008041

Scaffold Ga0103766_1008041

Overview

Basic Information
Taxon OID	3300008799 Open in IMG/M
Scaffold ID	Ga0103766_1008041 Open in IMG/M
Source Dataset Name	Planktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample NO3-1
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Duisburg-Essen
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	909
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond → Planktonic Communities From Eutrophic Pond At The Campus Essen Of The University Duisburg-essen, Germany

Source Dataset Sampling Location
Location Name	University Duisburg-Essen, Germany
Coordinates	Lat. (^o)	51.46	Long. (^o)	7.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004781	Metagenome / Metatranscriptome	423	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103766_10080411	F004781	N/A	HIRTFDNMRSDYYSPGEYWIVKSAAVWIQGRYLPLPSTSGLGVTKVIVVGGPFLKGHKLFVETRTATWDGQPVLQGFPSDFTVPGIVDMHYNGIGEVMQNGREGKALHIVHIRLEDGSPEGLQIQVNRWMEASEGDYINVKITMHKQPNQDGHCGNFNGIPADDDRIQVRARVGKTGVDPSVLLFDYKTPVVQANRPNINDCPADQLEAAKATCKEREHKFIPSMACLIDVCFGGKGFAAEG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.