NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103767_1005785

Scaffold Ga0103767_1005785


Overview

Basic Information
Taxon OID3300008800 Open in IMG/M
Scaffold IDGa0103767_1005785 Open in IMG/M
Source Dataset NamePlanktonic communities from eutrophic pond at the campus Essen of the University Duisburg-Essen, Germany - sample NO3-2
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Duisburg-Essen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1003
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Eutrophic Pond → Planktonic Communities From Eutrophic Pond At The Campus Essen Of The University Duisburg-essen, Germany

Source Dataset Sampling Location
Location NameUniversity Duisburg-Essen, Germany
CoordinatesLat. (o)51.46Long. (o)7.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000577Metagenome / Metatranscriptome1015Y

Sequences

Protein IDFamilyRBSSequence
Ga0103767_10057851F000577N/AQGEGPEECKTVYESMCETRYHEHDVEDDVVDCETIQDEKCEDVTQGYTTEKKCTKWPRQVCKTEKKQVKKYSPETECKKVPRELCGPSGCVLTPGPEECFDKKETVVQEVPEENCNLEPQRSCKHVTKLVPLLKPQEECVDIPKEVCSRSRTNPRKVQKPVVKKWCYVPTKESGLA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.