NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103378_1000805

Scaffold Ga0103378_1000805


Overview

Basic Information
Taxon OID3300008811 Open in IMG/M
Scaffold IDGa0103378_1000805 Open in IMG/M
Source Dataset NameMicrobial communities from dairy cow rumen, for metatranscriptome studies - 2155_rapeseed oil diet
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterAarhus University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)733
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From Dairy Cow Rumen, For Metatranscriptome Studies

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012427Metagenome / Metatranscriptome280N

Sequences

Protein IDFamilyRBSSequence
Ga0103378_10008051F012427N/ALIDSNKITKVTYVNDFVIPCYARWIEISGNKLILTGGEKDYIESLNSTYMFKFRQIGDTDEGFSAKVYHKKDMICKRRAHSLIYFNDFIYAISGVDKLEMIKKCEKYDIFNDEWIEIPELNYNRQNAALAIHNQRYLYAFSGYDGFRNVDTFEKLDFLNEEKGWELLELKSTSKDCEEVDVKKNRMGVISLDFDRMLIFGGERNNKEYKDAYIYEFYEKKFYQFADLVRTSNFIMSPVYSQGKY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.