NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103881_100296

Scaffold Ga0103881_100296


Overview

Basic Information
Taxon OID3300008833 Open in IMG/M
Scaffold IDGa0103881_100296 Open in IMG/M
Source Dataset NameEukaryotic communities of water from the North Atlantic ocean - ACM7
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Georgia
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)679
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Lingulodiniaceae → Lingulodinium → Lingulodinium polyedra(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Eukaryotic Communities Of Water From Amazon River, Brazil And North Atlantic Ocean

Source Dataset Sampling Location
Location NameNorth Pacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100323Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0103881_1002961F100323GGAGMSPAVEEPGLSLFCFAVYTKNTGSPKPSQELELFRMQRENSWSLFSCAEWAVYSDVVEDLGGGVKTIEVRDVKGDFNILKRKETGCWVNTGMFVQVWSAIRDAGHATNHNWVIKVDADAVFFPSKLVRALSDYTVPQEGVYMENCKYVDWGYFGNLEVFSKQAFITLVDNLETCYTSIPWKDGVLGGKYGPMGEDLFAQKCMD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.